SCOP 1.65: Domain d1i1ca2: 1i1c A:342-443

Lineage for d1i1ca2 (1i1c A:342-443)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [88593] (2 PDB entries)

8. Domain d1i1ca2: 1i1c A:342-443 [21537]
   Other proteins in same PDB: d1i1ca1, d1i1cb1

Details for d1i1ca2

PDB Entry: 1i1c, 2.7 Å

PDB Description: non-fcrn binding fc fragment of rat igg2a

SCOP Domain Sequences for d1i1ca2:

Sequence; same for both SEQRES and ATOM records:

>d1i1ca2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Rat (Rattus norvegicus)}
tprgpqvytmappkeemtqsqvsitcmvkgfyppdiytewkmngqpqenykntpptmdtd
gsyflysklnvkketwqqgntftcsvlheglenehtekslsh

Timeline for d1i1ca2:

• d1i1ca2 first appeared (with stable ids) in SCOP 1.55
  
• d1i1ca2 appears in SCOP 1.63
  
• d1i1ca2 appears in SCOP 1.67
  
• d1i1ca2 appears in the current release, SCOPe 2.08