Lineage for d3qq9c1 (3qq9 C:1-111)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2365636Domain d3qq9c1: 3qq9 C:1-111 [215359]
    Other proteins in same PDB: d3qq9c2, d3qq9l2
    automated match to d1rhha1
    complexed with so4

Details for d3qq9c1

PDB Entry: 3qq9 (more details), 1.64 Å

PDB Description: crystal structure of fab fragment of anti-human rsv (respiratory syncytial virus) f protein mab 101f
PDB Compounds: (C:) 101f light chain

SCOPe Domain Sequences for d3qq9c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qq9c1 b.1.1.0 (C:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divltqspaslavslgqratifcrasqsvdyngisymhwfqqkpgqppklliyaasnpes
giparftgsgsgtdftlnihpveeedaatyycqqiiedpwtfgggtkleik

SCOPe Domain Coordinates for d3qq9c1:

Click to download the PDB-style file with coordinates for d3qq9c1.
(The format of our PDB-style files is described here.)

Timeline for d3qq9c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qq9c2