![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon [88598] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88599] (3 PDB entries) |
![]() | Domain d1f6ad2: 1f6a D:439-544 [21535] Other proteins in same PDB: d1f6aa1, d1f6aa2, d1f6ab1, d1f6ad1 polysaccharide binding antibody complexed with cps, fuc, man, nag, so4; mutant |
PDB Entry: 1f6a (more details), 3.5 Å
SCOP Domain Sequences for d1f6ad2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f6ad2 b.1.1.2 (D:439-544) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens)} praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsvn
Timeline for d1f6ad2:
![]() Domains from other chains: (mouse over for more information) d1f6aa1, d1f6aa2, d1f6ab1, d1f6ab2 |