Lineage for d1f6ad2 (1f6a D:439-544)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289093Protein Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon [88598] (1 species)
  7. 289094Species Human (Homo sapiens) [TaxId:9606] [88599] (3 PDB entries)
  8. 289099Domain d1f6ad2: 1f6a D:439-544 [21535]
    Other proteins in same PDB: d1f6aa1, d1f6aa2, d1f6ab1, d1f6ad1
    polysaccharide binding antibody
    complexed with cps, fuc, man, nag, so4; mutant

Details for d1f6ad2

PDB Entry: 1f6a (more details), 3.5 Å

PDB Description: structure of the human ige-fc bound to its high affinity receptor fc(epsilon)ri(alpha)

SCOP Domain Sequences for d1f6ad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6ad2 b.1.1.2 (D:439-544) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens)}
praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt
kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsvn

SCOP Domain Coordinates for d1f6ad2:

Click to download the PDB-style file with coordinates for d1f6ad2.
(The format of our PDB-style files is described here.)

Timeline for d1f6ad2: