SCOPe 2.07: Domain d3qpaa_: 3qpa A:

Lineage for d3qpaa_ (3qpa A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.30: Cutinase-like [52260] (3 protein domains)
   minimal alpha/beta hydrolase lacking peripheral secondary structures; similar to a flavodoxin-like fold
   automatically mapped to Pfam PF01083

6. Protein automated matches [191066] (4 species)
   not a true protein

7. Species Nectria haematococca [TaxId:660122] [224909] (1 PDB entry)

8. Domain d3qpaa_: 3qpa A: [215342]
   automated match to d3qpca_

Details for d3qpaa_

PDB Entry: 3qpa, 0.85 Å

PDB Description: Structure of Fusarium Solani Cutinase expressed in Pichia pastoris

PDB Compounds: (A:) cutinase

SCOPe Domain Sequences for d3qpaa_:

Sequence; same for both SEQRES and ATOM records:

>d3qpaa_ c.69.1.30 (A:) automated matches {Nectria haematococca [TaxId: 660122]}
grttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgg
ayratlgdnalprgtssaairemlglfqqantkcpdatliaggyxqgaalaaasiedlds
airdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgslivaaphlaygpda
rgpapefliekvravrg

Timeline for d3qpaa_:

• d3qpaa_ first appeared in SCOPe 2.03
  
• d3qpaa_ appears in SCOPe 2.06