![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.30: Cutinase-like [52260] (3 proteins) minimal alpha/beta hydrolase lacking peripheral secondary structures; similar to a flavodoxin-like fold automatically mapped to Pfam PF01083 |
![]() | Protein automated matches [191066] (4 species) not a true protein |
![]() | Species Nectria haematococca [TaxId:660122] [224909] (1 PDB entry) |
![]() | Domain d3qpaa_: 3qpa A: [215342] automated match to d3qpca_ |
PDB Entry: 3qpa (more details), 0.85 Å
SCOPe Domain Sequences for d3qpaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qpaa_ c.69.1.30 (A:) automated matches {Nectria haematococca [TaxId: 660122]} grttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgg ayratlgdnalprgtssaairemlglfqqantkcpdatliaggyxqgaalaaasiedlds airdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgslivaaphlaygpda rgpapefliekvravrg
Timeline for d3qpaa_: