Lineage for d1f6ad1 (1f6a D:329-438)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104414Species Fc (human) IgE [49121] (2 PDB entries)
  8. 104419Domain d1f6ad1: 1f6a D:329-438 [21534]
    Other proteins in same PDB: d1f6aa1, d1f6aa2

Details for d1f6ad1

PDB Entry: 1f6a (more details), 3.5 Å

PDB Description: structure of the human ige-fc bound to its high affinity receptor fc(epsilon)ri(alpha)

SCOP Domain Sequences for d1f6ad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6ad1 b.1.1.2 (D:329-438) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgE}
cdsnprgvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhstrk
eekqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsg

SCOP Domain Coordinates for d1f6ad1:

Click to download the PDB-style file with coordinates for d1f6ad1.
(The format of our PDB-style files is described here.)

Timeline for d1f6ad1: