| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins) |
| Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species) N-terminal domain has double beta-helix fold |
| Species Escherichia coli [TaxId:562] [46798] (28 PDB entries) |
| Domain d3qopb2: 3qop B:138-207 [215335] Other proteins in same PDB: d3qopa1, d3qopb1 automated match to d1i5za1 complexed with cmp, gol |
PDB Entry: 3qop (more details), 1.96 Å
SCOPe Domain Sequences for d3qopb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qopb2 a.4.5.4 (B:138-207) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvyg
Timeline for d3qopb2: