SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3qopb2 (3qop B:138-207)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1982239Family a.4.5.4: CAP C-terminal domain-like [46796] (9 protein domains)
  6. 1982240Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
    N-terminal domain has double beta-helix fold
  7. 1982241Species Escherichia coli [TaxId:562] [46798] (27 PDB entries)
  8. 1982245Domain d3qopb2: 3qop B:138-207 [215335]
    Other proteins in same PDB: d3qopa1, d3qopb1
    automated match to d1i5za1
    complexed with cmp, gol

Details for d3qopb2

PDB Entry: 3qop (more details), 1.96 Å

PDB Description: domain-domain flexibility leads to allostery within the camp receptor protein (crp)
PDB Compounds: (B:) Catabolite gene activator

SCOPe Domain Sequences for d3qopb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qopb2 a.4.5.4 (B:138-207) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvyg

SCOPe Domain Coordinates for d3qopb2:

Click to download the PDB-style file with coordinates for d3qopb2.
(The format of our PDB-style files is described here.)

Timeline for d3qopb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qopb1