Lineage for d1f6ab2 (1f6a B:439-544)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1107354Protein Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon [88598] (1 species)
  7. 1107355Species Human (Homo sapiens) [TaxId:9606] [88599] (3 PDB entries)
  8. 1107359Domain d1f6ab2: 1f6a B:439-544 [21533]
    Other proteins in same PDB: d1f6aa1, d1f6aa2, d1f6ab1, d1f6ad1
    polysaccharide binding antibody
    complexed with cps, so4

Details for d1f6ab2

PDB Entry: 1f6a (more details), 3.5 Å

PDB Description: structure of the human ige-fc bound to its high affinity receptor fc(epsilon)ri(alpha)
PDB Compounds: (B:) ig epsilon chain c region

SCOPe Domain Sequences for d1f6ab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6ab2 b.1.1.2 (B:439-544) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens) [TaxId: 9606]}
praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt
kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsvn

SCOPe Domain Coordinates for d1f6ab2:

Click to download the PDB-style file with coordinates for d1f6ab2.
(The format of our PDB-style files is described here.)

Timeline for d1f6ab2: