SCOPe 2.03: Domain d3qo1a1: 3qo1 A:1-112

Lineage for d3qo1a1 (3qo1 A:1-112)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)

8. Domain d3qo1a1: 3qo1 A:1-112 [215321]
   Other proteins in same PDB: d3qo1a2
   automated match to d1rhha1
   complexed with gol

Details for d3qo1a1

PDB Entry: 3qo1, 2.4 Å

PDB Description: Monoclinic form of IgG1 Fab fragment (apo form) sharing same Fv as IgA

PDB Compounds: (A:) Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN

SCOPe Domain Sequences for d3qo1a1:

Sequence; same for both SEQRES and ATOM records:

>d3qo1a1 b.1.1.0 (A:1-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqsplslsvtpgepasiscrssqsllrrdghndlewylqkpgqspqpliylgstra
sgvpdrfsgsgsgtdftlkiirveaedagtyycmqnkqtpltfgqgtrleik

Timeline for d3qo1a1:

• d3qo1a1 is new in SCOPe 2.03-stable
  
• d3qo1a1 appears in SCOPe 2.04
  
• d3qo1a1 appears in the current release, SCOPe 2.08