SCOPe 2.04: Domain d3qnyd2: 3qny D:119-221

Lineage for d3qnyd2 (3qny D:119-221)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d3qnyd2: 3qny D:119-221 [215320]
   Other proteins in same PDB: d3qnya2, d3qnyc2
   automated match to d1mcph2
   complexed with gol

Details for d3qnyd2

PDB Entry: 3qny, 2.3 Å

PDB Description: Monoclinic form of human IgA1 Fab fragment, sharing same Fv as IgG

PDB Compounds: (D:) fab fragment of immunoglobulin a1 heavy chain

SCOPe Domain Sequences for d3qnyd2:

Sequence, based on SEQRES records:

>d3qnyd2 b.1.1.0 (D:119-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sasptspkvfplslcstqpdgnvviaclvqgffpqeplsvtwsesgqgvtarnfppsqda
sgdlyttssqltlpatqclagksvtchvkhytnpsqdvtvpcp

Sequence, based on observed residues (ATOM records):

>d3qnyd2 b.1.1.0 (D:119-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sasptspkvfplslcqpdgnvviaclvqgffpqeplsvtwsesgqgvtarnfppsqdasg
dlyttssqltlpatqclagksvtchvkhytnpsqdvtvpcp

Timeline for d3qnyd2:

• d3qnyd2 first appeared in SCOPe 2.03
  
• d3qnyd2 appears in SCOPe 2.05
  
• d3qnyd2 appears in the current release, SCOPe 2.08