SCOP 1.57: Domain d1f6ab1: 1f6a B:328-438

Lineage for d1f6ab1 (1f6a B:328-438)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)

7. Species Fc (human) IgE [49121] (2 PDB entries)

8. Domain d1f6ab1: 1f6a B:328-438 [21532]
   Other proteins in same PDB: d1f6aa1, d1f6aa2

Details for d1f6ab1

PDB Entry: 1f6a, 3.5 Å

PDB Description: structure of the human ige-fc bound to its high affinity receptor fc(epsilon)ri(alpha)

SCOP Domain Sequences for d1f6ab1:

Sequence; same for both SEQRES and ATOM records:

>d1f6ab1 b.1.1.2 (B:328-438) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgE}
pcdsnprgvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhstr
keekqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsg

Timeline for d1f6ab1:

• d1f6ab1 first appeared (with stable ids) in SCOP 1.55
  
• d1f6ab1 appears in SCOP 1.59
  
• d1f6ab1 appears in the current release, SCOPe 2.08