SCOPe 2.08: Domain d3qnyd1: 3qny D:4-118

Lineage for d3qnyd1 (3qny D:4-118)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3qnyd1: 3qny D:4-118 [215319]
   Other proteins in same PDB: d3qnya2, d3qnyc2
   automated match to d1mcph1
   complexed with gol

Details for d3qnyd1

PDB Entry: 3qny, 2.3 Å

PDB Description: Monoclinic form of human IgA1 Fab fragment, sharing same Fv as IgG

PDB Compounds: (D:) fab fragment of immunoglobulin a1 heavy chain

SCOPe Domain Sequences for d3qnyd1:

Sequence, based on SEQRES records:

>d3qnyd1 b.1.1.0 (D:4-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvesggglvqpggslklscaasgftlsgsnvhwvrqasgkglewvgrikrnaesdataya
asmrgrltisrddskntaflqmnslksddtamyycvirgdvynrqwgqgtlvtvs

Sequence, based on observed residues (ATOM records):

>d3qnyd1 b.1.1.0 (D:4-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvesggglvqpggslklscaasgftlsgsnvhwvrqasgkglewvgrikrnaesdataya
asmrgrltisrddskntaflqmnslksddtamyycvirqwgqgtlvtvs

Timeline for d3qnyd1:

• d3qnyd1 first appeared in SCOPe 2.03
  
• d3qnyd1 appears in SCOPe 2.07