Lineage for d1fp5a2 (1fp5 A:439-543)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1760571Protein Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon [88598] (1 species)
  7. 1760572Species Human (Homo sapiens) [TaxId:9606] [88599] (3 PDB entries)
  8. 1760573Domain d1fp5a2: 1fp5 A:439-543 [21531]
    Other proteins in same PDB: d1fp5a1

Details for d1fp5a2

PDB Entry: 1fp5 (more details), 2.3 Å

PDB Description: crystal structure analysis of the human ige-fc cepsilon3-cepsilon4 fragment.
PDB Compounds: (A:) ige heavy chain epsilon-1

SCOPe Domain Sequences for d1fp5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fp5a2 b.1.1.2 (A:439-543) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens) [TaxId: 9606]}
praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt
kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsv

SCOPe Domain Coordinates for d1fp5a2:

Click to download the PDB-style file with coordinates for d1fp5a2.
(The format of our PDB-style files is described here.)

Timeline for d1fp5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fp5a1