SCOP 1.65: Domain d1fp5a2: 1fp5 A:439-543

Lineage for d1fp5a2 (1fp5 A:439-543)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon [88598] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88599] (3 PDB entries)

8. Domain d1fp5a2: 1fp5 A:439-543 [21531]
   Other proteins in same PDB: d1fp5a1

Details for d1fp5a2

PDB Entry: 1fp5, 2.3 Å

PDB Description: crystal structure analysis of the human ige-fc cepsilon3-cepsilon4 fragment.

SCOP Domain Sequences for d1fp5a2:

Sequence; same for both SEQRES and ATOM records:

>d1fp5a2 b.1.1.2 (A:439-543) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens)}
praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt
kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsv

Timeline for d1fp5a2:

• d1fp5a2 first appeared (with stable ids) in SCOP 1.55
  
• d1fp5a2 appears in SCOP 1.63
  
• d1fp5a2 appears in SCOP 1.67
  
• d1fp5a2 appears in the current release, SCOPe 2.08