Lineage for d1fp5a2 (1fp5 A:439-543)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289093Protein Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon [88598] (1 species)
  7. 289094Species Human (Homo sapiens) [TaxId:9606] [88599] (3 PDB entries)
  8. 289095Domain d1fp5a2: 1fp5 A:439-543 [21531]
    Other proteins in same PDB: d1fp5a1

Details for d1fp5a2

PDB Entry: 1fp5 (more details), 2.3 Å

PDB Description: crystal structure analysis of the human ige-fc cepsilon3-cepsilon4 fragment.

SCOP Domain Sequences for d1fp5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fp5a2 b.1.1.2 (A:439-543) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens)}
praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt
kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsv

SCOP Domain Coordinates for d1fp5a2:

Click to download the PDB-style file with coordinates for d1fp5a2.
(The format of our PDB-style files is described here.)

Timeline for d1fp5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fp5a1