Lineage for d3qnxa1 (3qnx A:1-112)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765710Domain d3qnxa1: 3qnx A:1-112 [215309]
    Other proteins in same PDB: d3qnxa2
    automated match to d1rhha1
    complexed with gol

Details for d3qnxa1

PDB Entry: 3qnx (more details), 2.2 Å

PDB Description: Orthorhombic form of human IgA1 Fab fragment, sharing same Fv as IgG
PDB Compounds: (A:) fab fragment of immunoglobulin a1 light chain

SCOPe Domain Sequences for d3qnxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qnxa1 b.1.1.0 (A:1-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqsplslsvtpgepasiscrssqsllrrdghndlewylqkpgqspqpliylgstra
sgvpdrfsgsgsgtdftlkiirveaedagtyycmqnkqtpltfgqgtrleik

SCOPe Domain Coordinates for d3qnxa1:

Click to download the PDB-style file with coordinates for d3qnxa1.
(The format of our PDB-style files is described here.)

Timeline for d3qnxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qnxa2