SCOPe 2.08: Domain d3qnxa1: 3qnx A:1-112

Lineage for d3qnxa1 (3qnx A:1-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3qnxa1: 3qnx A:1-112 [215309]
   Other proteins in same PDB: d3qnxa2
   automated match to d1rhha1
   complexed with gol

Details for d3qnxa1

PDB Entry: 3qnx, 2.2 Å

PDB Description: Orthorhombic form of human IgA1 Fab fragment, sharing same Fv as IgG

PDB Compounds: (A:) fab fragment of immunoglobulin a1 light chain

SCOPe Domain Sequences for d3qnxa1:

Sequence; same for both SEQRES and ATOM records:

>d3qnxa1 b.1.1.0 (A:1-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqsplslsvtpgepasiscrssqsllrrdghndlewylqkpgqspqpliylgstra
sgvpdrfsgsgsgtdftlkiirveaedagtyycmqnkqtpltfgqgtrleik

Timeline for d3qnxa1:

• d3qnxa1 first appeared in SCOPe 2.03
  
• d3qnxa1 appears in SCOPe 2.07