Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (74 species) not a true protein |
Species Campylobacter jejuni [TaxId:197] [226083] (1 PDB entry) |
Domain d3qn3b2: 3qn3 B:137-414 [215303] Other proteins in same PDB: d3qn3a1, d3qn3a3, d3qn3b1, d3qn3b3, d3qn3c1, d3qn3c3, d3qn3d1, d3qn3d3 automated match to d1w6ta1 complexed with gol, mg, mpd, so4 |
PDB Entry: 3qn3 (more details), 2.13 Å
SCOPe Domain Sequences for d3qn3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qn3b2 c.1.11.0 (B:137-414) automated matches {Campylobacter jejuni [TaxId: 197]} nasilpvpmcniinggahannnvdfqefmimpfgftsfkealrsvceiyailkkelansg hstalgdeggfapnlanntepidllmtcikkagyenrvkialdvasteffkdgkyhmegk afssealieryvelcakypicsiedglaendfegwiklteklgnkiqlvgddlfvtnedi lregiikkmanavlikpnqigtitqtmrtvrlaqrnnykcvmshrsgesedafiadfava lntgqiktgalargertakynrlleiefesdeylgekl
Timeline for d3qn3b2: