Lineage for d3qn3b1 (3qn3 B:1-136)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948032Species Campylobacter jejuni [TaxId:197] [226082] (1 PDB entry)
  8. 2948034Domain d3qn3b1: 3qn3 B:1-136 [215302]
    Other proteins in same PDB: d3qn3a2, d3qn3a3, d3qn3b2, d3qn3b3, d3qn3c2, d3qn3c3, d3qn3d2, d3qn3d3
    automated match to d1w6ta2
    complexed with gol, mg, mpd, so4

Details for d3qn3b1

PDB Entry: 3qn3 (more details), 2.13 Å

PDB Description: phosphopyruvate hydratase from campylobacter jejuni.
PDB Compounds: (B:) enolase

SCOPe Domain Sequences for d3qn3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qn3b1 d.54.1.0 (B:1-136) automated matches {Campylobacter jejuni [TaxId: 197]}
mlviedvrayevldsrgnptvkaevtlsdgsvgaaivpsgastgskealelrdnderfgg
kgvlkavanvnetiadeilgldafnqtqlddtlreldgtnnysnlganatlgvsmatara
aaaalgmplyrylgga

SCOPe Domain Coordinates for d3qn3b1:

Click to download the PDB-style file with coordinates for d3qn3b1.
(The format of our PDB-style files is described here.)

Timeline for d3qn3b1: