Lineage for d1fp5a1 (1fp5 A:336-438)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 9138Species Fc (human) IgE [49121] (2 PDB entries)
  8. 9139Domain d1fp5a1: 1fp5 A:336-438 [21530]

Details for d1fp5a1

PDB Entry: 1fp5 (more details), 2.3 Å

PDB Description: crystal structure analysis of the human ige-fc cepsilon3-cepsilon4 fragment.

SCOP Domain Sequences for d1fp5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fp5a1 b.1.1.2 (A:336-438) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgE}
vsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhstrkeekqrng
tltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsg

SCOP Domain Coordinates for d1fp5a1:

Click to download the PDB-style file with coordinates for d1fp5a1.
(The format of our PDB-style files is described here.)

Timeline for d1fp5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fp5a2