Lineage for d1fp5a1 (1fp5 A:336-438)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein Immunoglobulin heavy chain epsilon constant domain 3, CH3-epsilon [88596] (1 species) Species Human (Homo sapiens) [TaxId:9606] [88597] (4 PDB entries) 
Domain d1fp5a1: 1fp5 A:336-438 [21530]
Other proteins in same PDB: d1fp5a2
Details for d1fp5a1
PDB Entry: 1fp5 (more details), 2.3 Å
PDB Description: crystal structure analysis of the human ige-fc cepsilon3-cepsilon4 fragment.
PDB Compounds: (A:) ige heavy chain epsilon-1SCOPe Domain Sequences for d1fp5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fp5a1 b.1.1.2 (A:336-438) Immunoglobulin heavy chain epsilon constant domain 3, CH3-epsilon {Human (Homo sapiens) [TaxId: 9606]}
vsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhstrkeekqrng
tltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsg
SCOPe Domain Coordinates for d1fp5a1:
Click to download the PDB-style file with coordinates for d1fp5a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fp5a1:
- d1fp5a1 first appeared (with stable ids) in SCOP 1.55
- d1fp5a1 appears in SCOPe 2.07
View in 3D
