SCOPe 2.07: Domain d3qmlb1: 3qml B:50-232

Lineage for d3qmlb1 (3qml B:50-232)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (63 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225411] (5 PDB entries)

8. Domain d3qmlb1: 3qml B:50-232 [215298]
   automated match to d1qqma1
   complexed with mg, po4

Details for d3qmlb1

PDB Entry: 3qml, 2.31 Å

PDB Description: The structural analysis of Sil1-Bip complex reveals the mechanism for Sil1 to function as a novel nucleotide exchange factor

PDB Compounds: (B:) 78 kDa glucose-regulated protein homolog

SCOPe Domain Sequences for d3qmlb1:

Sequence; same for both SEQRES and ATOM records:

>d3qmlb1 c.55.1.0 (B:50-232) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gtvigidlgttyscvavmkngkteilaneqgnritpsyvaftdderligdaaknqvaanp
qntifdikrliglkyndrsvqkdikhlpfnvvnkdgkpavevsvkgekkvftpeeisgmi
lgkmkqiaedylgtkvthavvtvpayfndaqrqatkdagtiaglnvlrivneptaaaiay
gld

Timeline for d3qmlb1:

• d3qmlb1 first appeared in SCOPe 2.03
  
• d3qmlb1 appears in SCOPe 2.06
  
• d3qmlb1 appears in the current release, SCOPe 2.08