![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (49 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225411] (5 PDB entries) |
![]() | Domain d3qmla1: 3qml A:48-234 [215296] automated match to d1qqma1 complexed with mg, po4 |
PDB Entry: 3qml (more details), 2.31 Å
SCOPe Domain Sequences for d3qmla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qmla1 c.55.1.0 (A:48-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} nygtvigidlgttyscvavmkngkteilaneqgnritpsyvaftdderligdaaknqvaa npqntifdikrliglkyndrsvqkdikhlpfnvvnkdgkpavevsvkgekkvftpeeisg milgkmkqiaedylgtkvthavvtvpayfndaqrqatkdagtiaglnvlrivneptaaai aygldks
Timeline for d3qmla1: