Lineage for d3qm9a_ (3qm9 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1475069Protein automated matches [190359] (38 species)
    not a true protein
  7. 1475352Species Thunnus atlanticus [TaxId:48168] [187921] (8 PDB entries)
  8. 1475353Domain d3qm9a_: 3qm9 A: [215294]
    automated match to d3qm7a_
    complexed with azi, edo, hem

Details for d3qm9a_

PDB Entry: 3qm9 (more details), 0.91 Å

PDB Description: Blackfin tuna azido-myoglobin, atomic resolution
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d3qm9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qm9a_ a.1.1.2 (A:) automated matches {Thunnus atlanticus [TaxId: 48168]}
adfdavlkcwgpveadyttigglvltrlfkehpetqklfpkfagiaqadiagnaavsahg
atvlkklgellkakgshaailkplanshatkhkipinnfklisevlvkvmqekagldagg
qtalrnvmgiiiadleanykelgfs

SCOPe Domain Coordinates for d3qm9a_:

Click to download the PDB-style file with coordinates for d3qm9a_.
(The format of our PDB-style files is described here.)

Timeline for d3qm9a_: