Lineage for d3qm2b_ (3qm2 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132875Species Salmonella enterica [TaxId:90371] [226773] (1 PDB entry)
  8. 2132877Domain d3qm2b_: 3qm2 B: [215290]
    automated match to d2c0ra_
    complexed with ca

Details for d3qm2b_

PDB Entry: 3qm2 (more details), 2.25 Å

PDB Description: 2.25 angstrom crystal structure of phosphoserine aminotransferase (serc) from salmonella enterica subsp. enterica serovar typhimurium
PDB Compounds: (B:) phosphoserine aminotransferase

SCOPe Domain Sequences for d3qm2b_:

Sequence, based on SEQRES records: (download)

>d3qm2b_ c.67.1.0 (B:) automated matches {Salmonella enterica [TaxId: 90371]}
qvfnfssgpamlpaevlklaqqelcdwhglgtsvmeishrgkefiqvaeeaeqdfrdlln
ipsnykvlfchgggrgqfagvplnllgdkttadyvdagywaasaikeakkycapqiidak
itvdgkravkpmrewqlsdnaaylhycpnetidgiaidetpdfgpevvvtadfsstilsa
pldvsrygviyagaqknigpagltlvivredllgkahescpsildytvlndndsmfntpp
tfawylsglvfkwlkaqggvaamhkinqqkaellygvidnsdfyrndvaqanrsrmnvpf
qladntldkvfleesfaaglhalkghrvvggmrasiynampiegvkaltdfmidferrhg

Sequence, based on observed residues (ATOM records): (download)

>d3qm2b_ c.67.1.0 (B:) automated matches {Salmonella enterica [TaxId: 90371]}
qvfnfssgpamlpaevlklaqqelvaeeaeqdfrdllnipsnykvlfchgggrgqfagvp
lnllgdkttadyvdagywaasaikeakkycapqiidakitvdgkravkpmrewqlsdnaa
ylhycpnetidgiaidetpdfgpevvvtadfsstilsapldvsrygviyagaqknigpag
ltlvivredllgkahescpsildytvlndnptfawylsglvfkwlkaqggvaamhkinqq
kaellygvidnsdfyrndvaqanrsrmnvpfqladntldkvfleesfaaglhalkghrvv
ggmrasiynampiegvkaltdfmidferrhg

SCOPe Domain Coordinates for d3qm2b_:

Click to download the PDB-style file with coordinates for d3qm2b_.
(The format of our PDB-style files is described here.)

Timeline for d3qm2b_: