SCOPe 2.08: Domain d3qlha1: 3qlh A:1-429

Lineage for d3qlha1 (3qlh A:1-429)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein automated matches [190211] (7 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 [TaxId:11678] [226272] (13 PDB entries)

8. Domain d3qlha1: 3qlh A:1-429 [215286]
   Other proteins in same PDB: d3qlha2, d3qlha3
   automated match to d1eeta2
   complexed with dms, edo, mn, mnk, t27

Details for d3qlha1

PDB Entry: 3qlh, 2.7 Å

PDB Description: hiv-1 reverse transcriptase in complex with manicol at the rnase h active site and tmc278 (rilpivirine) at the nnrti binding pocket

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d3qlha1:

Sequence; same for both SEQRES and ATOM records:

>d3qlha1 e.8.1.2 (A:1-429) automated matches {Human immunodeficiency virus type 1 [TaxId: 11678]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfaaqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

Timeline for d3qlha1:

• d3qlha1 first appeared in SCOPe 2.03
  
• d3qlha1 appears in SCOPe 2.07