![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein c-src tyrosine kinase [56155] (3 species) PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [56157] (54 PDB entries) |
![]() | Domain d3qlfb_: 3qlf B: [215283] automated match to d2gqgb_ complexed with pd5; mutant |
PDB Entry: 3qlf (more details), 2.75 Å
SCOPe Domain Sequences for d3qlfb_:
Sequence, based on SEQRES records: (download)
>d3qlfb_ d.144.1.7 (B:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]} daweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkki rheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayv ermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalyg rftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcq cwrkdpeerptfeylqafledyftstepqyqpgenl
>d3qlfb_ d.144.1.7 (B:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]} daweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpmspeaflqeaqvmkkirh eklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayver mnyvhrdlraanilvgenlvckvadfarfpikwtapeaalygrftiksdvwsfgilltel ttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqaf ledyftstepqyqpgenl
Timeline for d3qlfb_: