Lineage for d3qlfb_ (3qlf B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2218400Protein c-src tyrosine kinase [56155] (2 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 2218401Species Chicken (Gallus gallus) [TaxId:9031] [56157] (48 PDB entries)
  8. 2218454Domain d3qlfb_: 3qlf B: [215283]
    automated match to d2gqgb_
    complexed with pd5; mutant

Details for d3qlfb_

PDB Entry: 3qlf (more details), 2.75 Å

PDB Description: Crystal structure of the L317I mutant of the C-src tyrosine kinase domain complexed with pyrazolopyrimidine 5
PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d3qlfb_:

Sequence, based on SEQRES records: (download)

>d3qlfb_ d.144.1.7 (B:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
daweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkki
rheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayv
ermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalyg
rftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcq
cwrkdpeerptfeylqafledyftstepqyqpgenl

Sequence, based on observed residues (ATOM records): (download)

>d3qlfb_ d.144.1.7 (B:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
daweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpmspeaflqeaqvmkkirh
eklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayver
mnyvhrdlraanilvgenlvckvadfarfpikwtapeaalygrftiksdvwsfgilltel
ttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqaf
ledyftstepqyqpgenl

SCOPe Domain Coordinates for d3qlfb_:

Click to download the PDB-style file with coordinates for d3qlfb_.
(The format of our PDB-style files is described here.)

Timeline for d3qlfb_: