Lineage for d3ql1a_ (3ql1 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2174483Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2174484Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2174485Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2174613Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 2174614Species Cow (Bos taurus) [TaxId:9913] [54079] (188 PDB entries)
  8. 2174629Domain d3ql1a_: 3ql1 A: [215280]
    automated match to d3ql2b_
    complexed with act, edo, so4

Details for d3ql1a_

PDB Entry: 3ql1 (more details), 1.29 Å

PDB Description: Crystal Structure of Ribonuclease A Variant A4C/D83E/V118C
PDB Compounds: (A:) ribonuclease pancreatic

SCOPe Domain Sequences for d3ql1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ql1a_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketcaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitecretgsskypncaykttqankhiivacegnpyvpchf
dasv

SCOPe Domain Coordinates for d3ql1a_:

Click to download the PDB-style file with coordinates for d3ql1a_.
(The format of our PDB-style files is described here.)

Timeline for d3ql1a_: