Lineage for d3qjhb1 (3qjh B:2-119)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1766710Domain d3qjhb1: 3qjh B:2-119 [215271]
    Other proteins in same PDB: d3qjha2, d3qjhb2, d3qjhc2, d3qjhd2
    automated match to d1qrne1

Details for d3qjhb1

PDB Entry: 3qjh (more details), 1.9 Å

PDB Description: The crystal structure of the 5c.c7 TCR
PDB Compounds: (B:) 5c.c7 beta chain

SCOPe Domain Sequences for d3qjhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qjhb1 b.1.1.0 (B:2-119) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mkviqtprylvkgqgqkakmrcipekghpvvfwyqqnknnefkflinfqnqevlqqidmt
ekrfsaecpsnspcsleiqsseagdsalylcasslnnansdytfgsgtrllvied

SCOPe Domain Coordinates for d3qjhb1:

Click to download the PDB-style file with coordinates for d3qjhb1.
(The format of our PDB-style files is described here.)

Timeline for d3qjhb1: