Lineage for d3qjha1 (3qjh A:1-117)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759617Domain d3qjha1: 3qjh A:1-117 [215269]
    Other proteins in same PDB: d3qjha2, d3qjhb2, d3qjhc2, d3qjhd2
    automated match to d1qrnd1

Details for d3qjha1

PDB Entry: 3qjh (more details), 1.9 Å

PDB Description: The crystal structure of the 5c.c7 TCR
PDB Compounds: (A:) 5c.c7 alpha chain

SCOPe Domain Sequences for d3qjha1:

Sequence, based on SEQRES records: (download)

>d3qjha1 b.1.1.0 (A:1-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dqveqspsalslhegtgsalrcnftttmravqwfrknsrgslinlfylasgtkengrlks
afdskerystlhirdaqledsgtyfcaaeasntnkvvfgtgtrlqvlpn

Sequence, based on observed residues (ATOM records): (download)

>d3qjha1 b.1.1.0 (A:1-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dqveqspsalslhegtgsalrcnftttmravqwfrknrgslinlfylasgtkengrlksa
fdskerystlhirdaqledsgtyfcaaeasntnkvvfgtgtrlqvlpn

SCOPe Domain Coordinates for d3qjha1:

Click to download the PDB-style file with coordinates for d3qjha1.
(The format of our PDB-style files is described here.)

Timeline for d3qjha1: