SCOPe 2.08: Domain d3qjha1: 3qjh A:1-117

Lineage for d3qjha1 (3qjh A:1-117)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d3qjha1: 3qjh A:1-117 [215269]
   Other proteins in same PDB: d3qjha2, d3qjhb2, d3qjhc2, d3qjhd2
   automated match to d1qrnd1

Details for d3qjha1

PDB Entry: 3qjh, 1.9 Å

PDB Description: The crystal structure of the 5c.c7 TCR

PDB Compounds: (A:) 5c.c7 alpha chain

SCOPe Domain Sequences for d3qjha1:

Sequence, based on SEQRES records:

>d3qjha1 b.1.1.0 (A:1-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dqveqspsalslhegtgsalrcnftttmravqwfrknsrgslinlfylasgtkengrlks
afdskerystlhirdaqledsgtyfcaaeasntnkvvfgtgtrlqvlpn

Sequence, based on observed residues (ATOM records):

>d3qjha1 b.1.1.0 (A:1-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dqveqspsalslhegtgsalrcnftttmravqwfrknrgslinlfylasgtkengrlksa
fdskerystlhirdaqledsgtyfcaaeasntnkvvfgtgtrlqvlpn

Timeline for d3qjha1:

• d3qjha1 first appeared in SCOPe 2.03
  
• d3qjha1 appears in SCOPe 2.07