SCOPe 2.08: Domain d3qjfd2: 3qjf D:116-244

Lineage for d3qjfd2 (3qjf D:116-244)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d3qjfd2: 3qjf D:116-244 [215268]
   Other proteins in same PDB: d3qjfa2, d3qjfc2
   automated match to d1lp9f2

Details for d3qjfd2

PDB Entry: 3qjf, 2.4 Å

PDB Description: Crystal structure of the 2B4 TCR

PDB Compounds: (D:) 2B4 beta chain

SCOPe Domain Sequences for d3qjfd2:

Sequence; same for both SEQRES and ATOM records:

>d3qjfd2 b.1.1.0 (D:116-244) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d3qjfd2:

• d3qjfd2 first appeared in SCOPe 2.03
  
• d3qjfd2 appears in SCOPe 2.07