Lineage for d3qjfc2 (3qjf C:112-199)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2353824Species Mouse (Mus musculus) [TaxId:10090] [224855] (522 PDB entries)
  8. 2354078Domain d3qjfc2: 3qjf C:112-199 [215266]
    Other proteins in same PDB: d3qjfa1, d3qjfb1, d3qjfb2, d3qjfc1, d3qjfd1, d3qjfd2
    automated match to d1qrnd2

Details for d3qjfc2

PDB Entry: 3qjf (more details), 2.4 Å

PDB Description: Crystal structure of the 2B4 TCR
PDB Compounds: (C:) 2B4 alpha chain

SCOPe Domain Sequences for d3qjfc2:

Sequence, based on SEQRES records: (download)

>d3qjfc2 b.1.1.2 (C:112-199) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Sequence, based on observed residues (ATOM records): (download)

>d3qjfc2 b.1.1.2 (C:112-199) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdsksksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsav
awsnkfacanafnnsiipedtffp

SCOPe Domain Coordinates for d3qjfc2:

Click to download the PDB-style file with coordinates for d3qjfc2.
(The format of our PDB-style files is described here.)

Timeline for d3qjfc2: