Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries) |
Domain d3qjfb2: 3qjf B:116-243 [215264] Other proteins in same PDB: d3qjfa2, d3qjfc2 automated match to d1lp9f2 |
PDB Entry: 3qjf (more details), 2.4 Å
SCOPe Domain Sequences for d3qjfb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qjfb2 b.1.1.0 (B:116-243) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgra
Timeline for d3qjfb2: