Lineage for d3qjfb1 (3qjf B:2-115)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759952Domain d3qjfb1: 3qjf B:2-115 [215263]
    Other proteins in same PDB: d3qjfa2, d3qjfc2
    automated match to d1lp9f1

Details for d3qjfb1

PDB Entry: 3qjf (more details), 2.4 Å

PDB Description: Crystal structure of the 2B4 TCR
PDB Compounds: (B:) 2B4 beta chain

SCOPe Domain Sequences for d3qjfb1:

Sequence, based on SEQRES records: (download)

>d3qjfb1 b.1.1.0 (B:2-115) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
skviqtprylvkgqgqkakmrcipekghpvvfwyqqnknnefkflinfqnqevlqqidmt
ekrfsaecpsnspcsleiqsseagdsalylcasslnwsqdtqyfgpgtrllvle

Sequence, based on observed residues (ATOM records): (download)

>d3qjfb1 b.1.1.0 (B:2-115) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
skviqtprylvkgqgqkakmrcipekghpvvfwyqqnknnefkflinfqnqevlqqidmt
ekrfsaecpsnspcsleiqsseagdsalylcasslsqdtqyfgpgtrllvle

SCOPe Domain Coordinates for d3qjfb1:

Click to download the PDB-style file with coordinates for d3qjfb1.
(The format of our PDB-style files is described here.)

Timeline for d3qjfb1: