Lineage for d3qjfa1 (3qjf A:2-111)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1766886Domain d3qjfa1: 3qjf A:2-111 [215261]
    Other proteins in same PDB: d3qjfa2, d3qjfc2
    automated match to d1qrnd1

Details for d3qjfa1

PDB Entry: 3qjf (more details), 2.4 Å

PDB Description: Crystal structure of the 2B4 TCR
PDB Compounds: (A:) 2B4 alpha chain

SCOPe Domain Sequences for d3qjfa1:

Sequence, based on SEQRES records: (download)

>d3qjfa1 b.1.1.0 (A:2-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qveqspsalslhegtgsalrcnftttmravqwfqqnsrgslinlfylasgtkengrlkst
fnskesystlhirdaqledsgtyfcaalratggnnkltfgqgtvlsvipd

Sequence, based on observed residues (ATOM records): (download)

>d3qjfa1 b.1.1.0 (A:2-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qveqspsalslhegtgsalrcnftttmravqwfqqnsrgslinlfylasgtkengrlkst
fnskesystlhirdaqledsgtyfcaalratnnkltfgqgtvlsvipd

SCOPe Domain Coordinates for d3qjfa1:

Click to download the PDB-style file with coordinates for d3qjfa1.
(The format of our PDB-style files is described here.)

Timeline for d3qjfa1: