Lineage for d3qiud1 (3qiu D:2-116)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1296776Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)
  8. 1297094Domain d3qiud1: 3qiu D:2-116 [215256]
    Other proteins in same PDB: d3qiua1, d3qiua2, d3qiub1, d3qiub2, d3qiuc2, d3qiud2
    automated match to d1qrne1
    complexed with nag

Details for d3qiud1

PDB Entry: 3qiu (more details), 2.7 Å

PDB Description: crystal structure of the 226 tcr in complex with mcc/i-ek
PDB Compounds: (D:) TCR 226 beta chain

SCOPe Domain Sequences for d3qiud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qiud1 b.1.1.0 (D:2-116) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mkviqtprylvkgqgqkakmrcipekghpvvfwyqqnknnefkflinfqnqevlqqidmt
ekrfsaecpsnspcsleiqsseagdsalylcasslnnansdytfgsgtrllvied

SCOPe Domain Coordinates for d3qiud1:

Click to download the PDB-style file with coordinates for d3qiud1.
(The format of our PDB-style files is described here.)

Timeline for d3qiud1: