SCOPe 2.03: Domain d3qiuc2: 3qiu C:110-186

Lineage for d3qiuc2 (3qiu C:110-186)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries)

8. Domain d3qiuc2: 3qiu C:110-186 [215255]
   Other proteins in same PDB: d3qiua1, d3qiub1, d3qiuc1, d3qiud1
   automated match to d1qrnd2
   complexed with nag

Details for d3qiuc2

PDB Entry: 3qiu, 2.7 Å

PDB Description: crystal structure of the 226 tcr in complex with mcc/i-ek

PDB Compounds: (C:) TCR 226 alpha chain

SCOPe Domain Sequences for d3qiuc2:

Sequence, based on SEQRES records:

>d3qiuc2 b.1.1.2 (C:110-186) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafn

Sequence, based on observed residues (ATOM records):

>d3qiuc2 b.1.1.2 (C:110-186) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqdsdvyitdkcvldmrsmdfksnsav
awsacanafn

Timeline for d3qiuc2:

• d3qiuc2 is new in SCOPe 2.03-stable
  
• d3qiuc2 appears in SCOPe 2.04
  
• d3qiuc2 appears in the current release, SCOPe 2.08