Lineage for d1fcca2 (1fcc A:342-443)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549641Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 549644Species Human (Homo sapiens) [TaxId:9606] [88590] (22 PDB entries)
  8. 549679Domain d1fcca2: 1fcc A:342-443 [21525]
    Other proteins in same PDB: d1fcca1, d1fccc_
    part of a Fc

Details for d1fcca2

PDB Entry: 1fcc (more details), 3.5 Å

PDB Description: crystal structure of the c2 fragment of streptococcal protein g in complex with the fc domain of human igg

SCOP Domain Sequences for d1fcca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fcca2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens)}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

SCOP Domain Coordinates for d1fcca2:

Click to download the PDB-style file with coordinates for d1fcca2.
(The format of our PDB-style files is described here.)

Timeline for d1fcca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fcca1
View in 3D
Domains from other chains:
(mouse over for more information)
d1fccc_