SCOP 1.55: Domain d1fcca2: 1fcc A:342-443

Lineage for d1fcca2 (1fcc A:342-443)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fc (human) IgG1 class [49120] (6 PDB entries)

8. Domain d1fcca2: 1fcc A:342-443 [21525]
   Other proteins in same PDB: d1fccc_

Details for d1fcca2

PDB Entry: 1fcc, 3.5 Å

PDB Description: crystal structure of the c2 fragment of streptococcal protein g in complex with the fc domain of human igg

SCOP Domain Sequences for d1fcca2:

Sequence; same for both SEQRES and ATOM records:

>d1fcca2 b.1.1.2 (A:342-443) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgG1 class}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

Timeline for d1fcca2:

• d1fcca2 appears in SCOP 1.57
  
• d1fcca2 appears in the current release, SCOPe 2.08