SCOPe 2.08: Domain d3qibd2: 3qib D:117-243

Lineage for d3qibd2 (3qib D:117-243)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
Domain d3qibd2: 3qib D:117-243 [215247]
Other proteins in same PDB: d3qiba1, d3qibb1, d3qibb2, d3qibc1, d3qibd1
automated match to d1qsee2
complexed with bma, fuc, nag, peg

Details for d3qibd2

PDB Entry: 3qib (more details), 2.7 Å

PDB Description: crystal structure of the 2b4 tcr in complex with mcc/i-ek

PDB Compounds: (D:) 2B4 beta chain

SCOPe Domain Sequences for d3qibd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qibd2 b.1.1.2 (D:117-243) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgra

SCOPe Domain Coordinates for d3qibd2:

Click to download the PDB-style file with coordinates for d3qibd2.
(The format of our PDB-style files is described here.)

Timeline for d3qibd2: