SCOPe 2.08: Domain d3qibc2: 3qib C:112-201

Lineage for d3qibc2 (3qib C:112-201)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3qibc2: 3qib C:112-201 [215245]
   Other proteins in same PDB: d3qiba1, d3qibb1, d3qibb2, d3qibc1, d3qibd1
   automated match to d1qrnd2
   complexed with bma, fuc, nag, peg

Details for d3qibc2

PDB Entry: 3qib, 2.7 Å

PDB Description: crystal structure of the 2b4 tcr in complex with mcc/i-ek

PDB Compounds: (C:) T-cell receptor alpha chain c region

SCOPe Domain Sequences for d3qibc2:

Sequence, based on SEQRES records:

>d3qibc2 b.1.1.2 (C:112-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

Sequence, based on observed residues (ATOM records):

>d3qibc2 b.1.1.2 (C:112-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqdsdvyitdkcvldmrsmdfksnsav
awsfacanafnnsiipedtffpsp

Timeline for d3qibc2:

• d3qibc2 first appeared in SCOPe 2.03
  
• d3qibc2 appears in SCOPe 2.07