Lineage for d3qibb2 (3qib B:94-186)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2350049Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 2350149Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (11 PDB entries)
    probably orthologous to the human HLA-DR group
  8. 2350157Domain d3qibb2: 3qib B:94-186 [215243]
    Other proteins in same PDB: d3qiba1, d3qiba2, d3qibb1, d3qibc1, d3qibc2, d3qibd1, d3qibd2
    automated match to d1ktdb1
    complexed with bma, fuc, nag, peg

Details for d3qibb2

PDB Entry: 3qib (more details), 2.7 Å

PDB Description: Crystal structure of the 2B4 TCR in complex with MCC/I-Ek
PDB Compounds: (B:) MHC class II E-beta-k

SCOPe Domain Sequences for d3qibb2:

Sequence, based on SEQRES records: (download)

>d3qibb2 b.1.1.2 (B:94-186) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
rveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdw
tfqtlvmletvpqsgevytcqvehpsltdpvtv

Sequence, based on observed residues (ATOM records): (download)

>d3qibb2 b.1.1.2 (B:94-186) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
rveptvtvypllvcsvsdfypgnievrwngkeektgivstglvrngdwtfqtlvmletvt
cqvehpsltdpvtv

SCOPe Domain Coordinates for d3qibb2:

Click to download the PDB-style file with coordinates for d3qibb2.
(The format of our PDB-style files is described here.)

Timeline for d3qibb2: