Lineage for d3qibb1 (3qib B:3-93)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2506505Family d.19.1.1: MHC antigen-recognition domain [54453] (13 protein domains)
  6. 2507281Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2507390Species Mouse (Mus musculus), I-EK [TaxId:10090] [88827] (10 PDB entries)
  8. 2507397Domain d3qibb1: 3qib B:3-93 [215242]
    Other proteins in same PDB: d3qiba1, d3qiba2, d3qibb2, d3qibc1, d3qibc2, d3qibd1, d3qibd2
    automated match to d1kt2b2
    complexed with bma, fuc, nag, peg

Details for d3qibb1

PDB Entry: 3qib (more details), 2.7 Å

PDB Description: Crystal structure of the 2B4 TCR in complex with MCC/I-Ek
PDB Compounds: (B:) MHC class II E-beta-k

SCOPe Domain Sequences for d3qibb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qibb1 d.19.1.1 (B:3-93) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]}
srpwfleycksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwn
sqpefleqkraevdtvcrhnyeifdnflvpr

SCOPe Domain Coordinates for d3qibb1:

Click to download the PDB-style file with coordinates for d3qibb1.
(The format of our PDB-style files is described here.)

Timeline for d3qibb1: