| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (12 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries) |
| Domain d3qiba2: 3qib A:82-180 [215241] Other proteins in same PDB: d3qiba1, d3qibb1, d3qibc1, d3qibd1 automated match to d2fsea1 complexed with bma, fuc, nag, peg |
PDB Entry: 3qib (more details), 2.7 Å
SCOPe Domain Sequences for d3qiba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qiba2 b.1.1.2 (A:82-180) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
Timeline for d3qiba2: