Lineage for d3qiba1 (3qib A:1-81)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2545715Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2545716Protein automated matches [226842] (5 species)
    not a true protein
  7. 2545946Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)
  8. 2545983Domain d3qiba1: 3qib A:1-81 [215240]
    Other proteins in same PDB: d3qiba2, d3qibb1, d3qibb2, d3qibc1, d3qibc2, d3qibd1, d3qibd2
    automated match to d2g9ha2
    complexed with bma, fuc, nag, peg

Details for d3qiba1

PDB Entry: 3qib (more details), 2.7 Å

PDB Description: crystal structure of the 2b4 tcr in complex with mcc/i-ek
PDB Compounds: (A:) H-2 class II histocompatibility antigen, E-K alpha chain

SCOPe Domain Sequences for d3qiba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qiba1 d.19.1.0 (A:1-81) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
aniavdkanldvmkersnntp

SCOPe Domain Coordinates for d3qiba1:

Click to download the PDB-style file with coordinates for d3qiba1.
(The format of our PDB-style files is described here.)

Timeline for d3qiba1: