SCOPe 2.08: Domain d1fcca1: 1fcc A:238-341

Lineage for d1fcca1 (1fcc A:238-341)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (61 PDB entries)
   Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region

8. Domain d1fcca1: 1fcc A:238-341 [21524]
   Other proteins in same PDB: d1fcca2, d1fccb2, d1fccc_, d1fccd_
   part of a Fc

Details for d1fcca1

PDB Entry: 1fcc, 3.2 Å

PDB Description: crystal structure of the c2 fragment of streptococcal protein g in complex with the fc domain of human igg

PDB Compounds: (A:) igg1 mo61 fc

SCOPe Domain Sequences for d1fcca1:

Sequence; same for both SEQRES and ATOM records:

>d1fcca1 b.1.1.2 (A:238-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg

Timeline for d1fcca1:

• d1fcca1 first appeared (with stable ids) in SCOP 1.55
  
• d1fcca1 appears in SCOPe 2.07