SCOPe 2.08: Domain d3qhfl1: 3qhf L:1-107

Lineage for d3qhfl1 (3qhf L:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3qhfl1: 3qhf L:1-107 [215234]
   Other proteins in same PDB: d3qhfl2
   automated match to d1aqkl1

Details for d3qhfl1

PDB Entry: 3qhf, 1.66 Å

PDB Description: crystal structure of fab del2d1, a deletion variant of anti-influenza antibody 2d1

PDB Compounds: (L:) Human monoclonal antibody del2D1, Fab Light Chain

SCOPe Domain Sequences for d3qhfl1:

Sequence; same for both SEQRES and ATOM records:

>d3qhfl1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epvltqppsasgtpgqrvtiscsgsssnigsntvswyqqvpgtapklliygnnerpsgvp
drfsgsksatsaslaisglqsedeadyycaawddslngfwvfgggtkltvlg

Timeline for d3qhfl1:

• d3qhfl1 first appeared in SCOPe 2.03
  
• d3qhfl1 appears in SCOPe 2.07