SCOPe 2.06: Domain d3qh3d1: 3qh3 D:1-116

Lineage for d3qh3d1 (3qh3 D:1-116)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d3qh3d1: 3qh3 D:1-116 [215232]
   Other proteins in same PDB: d3qh3a1, d3qh3a2, d3qh3b2, d3qh3c1, d3qh3c2, d3qh3d2
   automated match to d1ktke1
   complexed with edo, gol

Details for d3qh3d1

PDB Entry: 3qh3, 2.19 Å

PDB Description: The crystal structure of TCR A6

PDB Compounds: (D:) A6 beta chain

SCOPe Domain Sequences for d3qh3d1:

Sequence, based on SEQRES records:

>d3qh3d1 b.1.1.0 (D:1-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nagvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgev
pngynvsrsttedfplrllsaapsqtsvyfcasrpglaggrpeqyfgpgtrltvte

Sequence, based on observed residues (ATOM records):

>d3qh3d1 b.1.1.0 (D:1-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nagvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgev
pngynvsrsttedfplrllsaapsqtsvyfcasrpglpeqyfgpgtrltvte

Timeline for d3qh3d1:

• d3qh3d1 first appeared in SCOPe 2.03
  
• d3qh3d1 appears in SCOPe 2.05
  
• d3qh3d1 appears in SCOPe 2.07
  
• d3qh3d1 appears in the current release, SCOPe 2.08