Lineage for d3qh3d1 (3qh3 D:1-116)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755303Domain d3qh3d1: 3qh3 D:1-116 [215232]
    Other proteins in same PDB: d3qh3a1, d3qh3a2, d3qh3b2, d3qh3c1, d3qh3c2, d3qh3d2
    automated match to d1ktke1
    complexed with edo, gol

Details for d3qh3d1

PDB Entry: 3qh3 (more details), 2.19 Å

PDB Description: The crystal structure of TCR A6
PDB Compounds: (D:) A6 beta chain

SCOPe Domain Sequences for d3qh3d1:

Sequence, based on SEQRES records: (download)

>d3qh3d1 b.1.1.0 (D:1-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nagvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgev
pngynvsrsttedfplrllsaapsqtsvyfcasrpglaggrpeqyfgpgtrltvte

Sequence, based on observed residues (ATOM records): (download)

>d3qh3d1 b.1.1.0 (D:1-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nagvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgev
pngynvsrsttedfplrllsaapsqtsvyfcasrpglpeqyfgpgtrltvte

SCOPe Domain Coordinates for d3qh3d1:

Click to download the PDB-style file with coordinates for d3qh3d1.
(The format of our PDB-style files is described here.)

Timeline for d3qh3d1: