SCOPe 2.07: Domain d3qg7l1: 3qg7 L:1-107

Lineage for d3qg7l1 (3qg7 L:1-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)

8. Domain d3qg7l1: 3qg7 L:1-107 [215222]
   Other proteins in same PDB: d3qg7l2
   automated match to d1t66c1
   complexed with na, p6g

Details for d3qg7l1

PDB Entry: 3qg7, 2.78 Å

PDB Description: Structural Basis for Ligand Recognition and Discrimination of a Quorum Quenching Antibody

PDB Compounds: (L:) AP4-24H11 Antibody Light Chain

SCOPe Domain Sequences for d3qg7l1:

Sequence; same for both SEQRES and ATOM records:

>d3qg7l1 b.1.1.1 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvltqtplslpvslgdqasiscrssqrlvhsngniylhwflqkpgqspklliyklssrf
sgvpdrfsgsgsgtdftlkisrvesedlgiyycsqtthvpytfgggtkleik

Timeline for d3qg7l1:

• d3qg7l1 first appeared in SCOPe 2.03
  
• d3qg7l1 appears in SCOPe 2.06
  
• d3qg7l1 appears in the current release, SCOPe 2.08