Lineage for d3qfua2 (3qfu A:235-426)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1373353Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1373354Protein automated matches [226839] (35 species)
    not a true protein
  7. 1373365Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225411] (5 PDB entries)
  8. 1373371Domain d3qfua2: 3qfu A:235-426 [215221]
    automated match to d1qqma2
    complexed with adp, mg, po4

Details for d3qfua2

PDB Entry: 3qfu (more details), 1.8 Å

PDB Description: Crystal structure of Yeast Hsp70 (Bip/kar2) complexed with ADP
PDB Compounds: (A:) 78 kDa glucose-regulated protein homolog

SCOPe Domain Sequences for d3qfua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qfua2 c.55.1.0 (A:235-426) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dkehqiivydlgggtfdvsllsiengvfevqatsgdthlggedfdykivrqlikafkkkh
gidvsdnnkalaklkreaekakralssqmstrieidsfvdgidlsetltrakfeelnldl
fkktlkpvekvlqdsglekkdvddivlvggstripkvqqllesyfdgkkaskginpdeav
aygaavqagvls

SCOPe Domain Coordinates for d3qfua2:

Click to download the PDB-style file with coordinates for d3qfua2.
(The format of our PDB-style files is described here.)

Timeline for d3qfua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qfua1